SCOPe 2.06: Domain d3kwce_: 3kwc E:

Lineage for d3kwce_ (3kwc E:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (30 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [225842] (3 PDB entries)

8. Domain d3kwce_: 3kwc E: [247297]
   automated match to d3ow5a_
   complexed with cl, ipa, zn

Details for d3kwce_

PDB Entry: 3kwc, 2 Å

PDB Description: Oxidized, active structure of the beta-carboxysomal gamma-Carbonic Anhydrase, CcmM

PDB Compounds: (E:) Carbon dioxide concentrating mechanism protein

SCOPe Domain Sequences for d3kwce_:

Sequence; same for both SEQRES and ATOM records:

>d3kwce_ b.81.1.0 (E:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
qsyaapptpwsrdlaepeiaptayvhsfsnligdvrikdyvhiapgtsiradegtpfhig
srtniqdgvvihglqqgrvigddgqeysvwigdnvsithmalihgpayigdgcfigfrst
vfnarvgagcvvmmhvliqdveippgkyvpsgmvittqqqadrlpnveesdihfaqhvvg
ineallsgyqcaeniaciapirnel

Timeline for d3kwce_:

• d3kwce_ first appeared in SCOPe 2.04
  
• d3kwce_ appears in SCOPe 2.05
  
• d3kwce_ appears in SCOPe 2.07
  
• d3kwce_ appears in the current release, SCOPe 2.08