Class b: All beta proteins [48724] (176 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.0: automated matches [191560] (1 protein) not a true family |
Protein automated matches [190967] (28 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [225842] (3 PDB entries) |
Domain d3kwcc_: 3kwc C: [247295] automated match to d3ow5a_ complexed with cl, ipa, zn |
PDB Entry: 3kwc (more details), 2 Å
SCOPe Domain Sequences for d3kwcc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kwcc_ b.81.1.0 (C:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} qsyaapptpwsrdlaepeiaptayvhsfsnligdvrikdyvhiapgtsiradegtpfhig srtniqdgvvihglqqgrvigddgqeysvwigdnvsithmalihgpayigdgcfigfrst vfnarvgagcvvmmhvliqdveippgkyvpsgmvittqqqadrlpnveesdihfaqhvvg ineallsgyqcaeniaciapirnel
Timeline for d3kwcc_: