![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
![]() | Superfamily b.35.1: GroES-like [50129] (3 families) ![]() |
![]() | Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins) C-terminal domain is alpha/beta (classical Rossmann-fold) |
![]() | Protein Alcohol dehydrogenase [50137] (9 species) contains a Zn-finger subdomain, residues 94-117 |
![]() | Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (24 PDB entries) Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327 |
![]() | Domain d1d1sc1: 1d1s C:1-162,C:339-374 [24729] Other proteins in same PDB: d1d1sa2, d1d1sb2, d1d1sc2, d1d1sd2 sigma isozyme complexed with act, cac, nad, zn |
PDB Entry: 1d1s (more details), 2.5 Å
SCOPe Domain Sequences for d1d1sc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d1sc1 b.35.1.2 (C:1-162,C:339-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} gtagkvikckaavlweqkqpfsieeievappktkevrikilatgicrtddhvikgtmvsk fpvivgheatgivesigegvttvkpgdkviplflpqcrecnacrnpdgnlcirsditgrg vladgttrftckgkpvhhfmntstfteytvvdessvakiddXkfdldqlithvlpfkkis egfellnsgqsirtvltf
Timeline for d1d1sc1: