Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins) contains a conserved all-alpha subdomain at the C-terminal extension |
Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (5 species) overall structure is similar to TyrRS |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255912] (4 PDB entries) |
Domain d3kt8d_: 3kt8 D: [247285] automated match to d1ulhb_ protein/RNA complex; complexed with ltn, so4 |
PDB Entry: 3kt8 (more details), 3 Å
SCOPe Domain Sequences for d3kt8d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kt8d_ c.26.1.1 (D:) Tryptophanyl-tRNA synthetase (TrpRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} elkstdvkeqvvtpwdveggvdeqgraqnidydklikqfgtkpvneetlkrfkqvtgrep hhflrkglffserdftkildlyeqgkpfflytgrgpssdsmhlghmipfvftkwlqevfd vplvieltddekflfkhkltindvknfarenakdiiavgfdpkntfifsdlqymggafye tvvrvsrqitgstakavfgfndsdcigkfhfasiqiatafpssfpnvlglpdktpclipc aidqdpyfrvcrdvadklkyskpallhsrffpalqgsttkmsasddttaifmtdtpkqiq kkinkyafsggqvsadlhrelggnpdvdvayqylsffkdddvflkecydkyksgellsge mkklcietlqefvkafqerraqvdeetldkfmvphklvwgekerlvapkp
Timeline for d3kt8d_: