Lineage for d3kt6b_ (3kt6 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860046Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2860140Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (5 species)
    overall structure is similar to TyrRS
  7. 2860191Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255912] (4 PDB entries)
  8. 2860198Domain d3kt6b_: 3kt6 B: [247279]
    automated match to d1ulhb_
    protein/RNA complex; complexed with so4, trp

Details for d3kt6b_

PDB Entry: 3kt6 (more details), 2.8 Å

PDB Description: crystal structure of s. cerevisiae tryptophanyl-trna synthetase in complex with trp
PDB Compounds: (B:) Tryptophanyl-tRNA synthetase, cytoplasmic

SCOPe Domain Sequences for d3kt6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kt6b_ c.26.1.1 (B:) Tryptophanyl-tRNA synthetase (TrpRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vkeqvvtpwdveggvdeqgraqnidydklikqfgtkpvneetlkrfkqvtgrephhflrk
glffserdftkildlyeqgkpfflytgrgpssdsmhlghmipfvftkwlqevfdvplvie
ltddekflfkhkltindvknfarenakdiiavgfdpkntfifsdlqymggafyetvvrvs
rqitgstakavfgfndsdcigkfhfasiqiatafpssfpnvlglpdktpclipcaidqdp
yfrvcrdvadklkyskpallhsrffpalqgsttkmsasddttaifmtdtpkqiqkkinky
afsggqvsadlhrelggnpdvdvayqylsffkdddvflkecydkyksgellsgemkklci
etlqefvkafqerraqvdeetldkfmvphklvwgekerlvapkp

SCOPe Domain Coordinates for d3kt6b_:

Click to download the PDB-style file with coordinates for d3kt6b_.
(The format of our PDB-style files is described here.)

Timeline for d3kt6b_: