Lineage for d3kt3b_ (3kt3 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1841352Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1841353Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 1841446Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (5 species)
    overall structure is similar to TyrRS
  7. 1841497Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255912] (4 PDB entries)
  8. 1841500Domain d3kt3b_: 3kt3 B: [247273]
    automated match to d1ulhb_
    protein/RNA complex; complexed with so4, tym

Details for d3kt3b_

PDB Entry: 3kt3 (more details), 2.6 Å

PDB Description: crystal structure of s. cerevisiae tryptophanyl-trna synthetase in complex with trpamp
PDB Compounds: (B:) Tryptophanyl-tRNA synthetase, cytoplasmic

SCOPe Domain Sequences for d3kt3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kt3b_ c.26.1.1 (B:) Tryptophanyl-tRNA synthetase (TrpRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dvkeqvvtpwdveggvdeqgraqnidydklikqfgtkpvneetlkrfkqvtgrephhflr
kglffserdftkildlyeqgkpfflytgrgpssdsmhlghmipfvftkwlqevfdvplvi
eltddekflfkhkltindvknfarenakdiiavgfdpkntfifsdlqymggafyetvvrv
srqitgstakavfgfndsdcigkfhfasiqiatafpssfpnvlglpdktpclipcaidqd
pyfrvcrdvadklkyskpallhsrffpalqgsttkmsasddttaifmtdtpkqiqkkink
yafsggqvsadlhrelggnpdvdvayqylsffkdddvflkecydkyksgellsgemkklc
ietlqefvkafqerraqvdeetldkfmvphklvwgekerlvapkp

SCOPe Domain Coordinates for d3kt3b_:

Click to download the PDB-style file with coordinates for d3kt3b_.
(The format of our PDB-style files is described here.)

Timeline for d3kt3b_: