Lineage for d3kswa_ (3ksw A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005985Species Trypanosoma cruzi [TaxId:5693] [196511] (10 PDB entries)
  8. 2005997Domain d3kswa_: 3ksw A: [247268]
    automated match to d3khma_
    complexed with hem, vnf

Details for d3kswa_

PDB Entry: 3ksw (more details), 3.05 Å

PDB Description: Crystal structure of sterol 14alpha-demethylase (CYP51) from Trypanosoma cruzi in complex with an inhibitor VNF ((4-(4-chlorophenyl)-N-[2-(1H-imidazol-1-yl)-1-phenylethyl]benzamide)
PDB Compounds: (A:) Sterol 14-alpha demethylase

SCOPe Domain Sequences for d3kswa_:

Sequence, based on SEQRES records: (download)

>d3kswa_ a.104.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
ktppvypvtvpflghivqfgknplefmqrckrdlksgvftisiggqrvtivgdphehsrf
fsprneilsprevytimtpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqhe
vrkfmaenwkedegvinlledcgamiintacqclfgedlrkrlnarhfaqllskmessli
paavfmpwllrlplpqsarcrearaelqkilgeiivarekeeaskdnntsdllggllkav
yrdgtrmslhevcgmivaamfagqhtstittswsmlhlmhpknkkwldklhkeidefpaq
lnydnvmdempfaercvresirrdppllmvmrmvkaevkvgsyvvpkgdiiacspllshh
deeafpnprlwdperdekvdgafigfgagvhkcigqkfallqvktilatafreydfqllr
devpdpdyhtmvvgptlnqclvkytrkk

Sequence, based on observed residues (ATOM records): (download)

>d3kswa_ a.104.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
ktppvypvtvpflghivqfgknplefmqrckrdlksgvftisiggqrvtivgdphehsrf
fsprneilsprevytimtpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqhe
vrkfmaenwkedegvinlledcgamiintacqclfgedlrkrlnarhfaqllskmessli
paavfmplplpqsarcrearaelqkilgeiivarekeeaskdnntsdllggllkavyrdg
trmslhevcgmivaamfagqhtstittswsmlhlmhpknkkwldklhkeidefpaqlnyd
nvmdempfaercvresirrdppllmvmrmvkaevkvgsyvvpkgdiiacspllshhdeea
fpnprlwdperdekvdgafigfgagvhkcigqkfallqvktilatafreydfqllrdevp
dpdyhtmvvgptlnqclvkytrkk

SCOPe Domain Coordinates for d3kswa_:

Click to download the PDB-style file with coordinates for d3kswa_.
(The format of our PDB-style files is described here.)

Timeline for d3kswa_: