![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) ![]() |
![]() | Family c.52.1.6: Restriction endonuclease PvuII [52996] (2 proteins) automatically mapped to Pfam PF09225 |
![]() | Protein automated matches [254694] (1 species) not a true protein |
![]() | Species Proteus vulgaris [TaxId:585] [255911] (1 PDB entry) |
![]() | Domain d3kska1: 3ksk A:2-159 [247264] Other proteins in same PDB: d3kska3, d3kskb3 automated match to d1ni0c_ complexed with mpd, so4, trs |
PDB Entry: 3ksk (more details), 2.35 Å
SCOPe Domain Sequences for d3kska1:
Sequence, based on SEQRES records: (download)
>d3kska1 c.52.1.6 (A:2-159) automated matches {Proteus vulgaris [TaxId: 585]} shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavd nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle fyydkwerkwysdghkdinnpkipvkyvmehgtkiygs
>d3kska1 c.52.1.6 (A:2-159) automated matches {Proteus vulgaris [TaxId: 585]} shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgndavdnag qeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdlefyy dkwerkwysdghkdinnpkipvkyvmehgtkiygs
Timeline for d3kska1: