Class b: All beta proteins [48724] (177 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
Protein automated matches [190052] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186914] (54 PDB entries) |
Domain d3krxa3: 3krx A:550-671 [247257] Other proteins in same PDB: d3krxa1, d3krxa2, d3krxb_, d3krxg_ automated match to d1omwa2 complexed with ba1, mg |
PDB Entry: 3krx (more details), 3.1 Å
SCOPe Domain Sequences for d3krxa3:
Sequence, based on SEQRES records: (download)
>d3krxa3 b.55.1.0 (A:550-671) automated matches {Human (Homo sapiens) [TaxId: 9606]} eedyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsv eetqikerkclllkirggkqfilqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkpr sp
>d3krxa3 b.55.1.0 (A:550-671) automated matches {Human (Homo sapiens) [TaxId: 9606]} eedyalgkdcimhgymskmwqrryfylfpnrlewrgegeapqslltmeeiqsveetqike rkclllkirggkqfilqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkprsp
Timeline for d3krxa3: