Lineage for d3krxa3 (3krx A:550-671)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070980Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2070981Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2071584Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2071585Protein automated matches [190052] (6 species)
    not a true protein
  7. 2071626Species Human (Homo sapiens) [TaxId:9606] [186914] (54 PDB entries)
  8. 2071677Domain d3krxa3: 3krx A:550-671 [247257]
    Other proteins in same PDB: d3krxa1, d3krxa2, d3krxb_, d3krxg_
    automated match to d1omwa2
    complexed with ba1, mg

Details for d3krxa3

PDB Entry: 3krx (more details), 3.1 Å

PDB Description: Human GRK2 in complex with Gbetgamma subunits and balanol (co-crystal)
PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d3krxa3:

Sequence, based on SEQRES records: (download)

>d3krxa3 b.55.1.0 (A:550-671) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eedyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsv
eetqikerkclllkirggkqfilqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkpr
sp

Sequence, based on observed residues (ATOM records): (download)

>d3krxa3 b.55.1.0 (A:550-671) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eedyalgkdcimhgymskmwqrryfylfpnrlewrgegeapqslltmeeiqsveetqike
rkclllkirggkqfilqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkprsp

SCOPe Domain Coordinates for d3krxa3:

Click to download the PDB-style file with coordinates for d3krxa3.
(The format of our PDB-style files is described here.)

Timeline for d3krxa3: