Lineage for d3krxa2 (3krx A:186-549)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 protein domains)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (17 species)
    not a true protein
  7. 2545220Species Human (Homo sapiens) [TaxId:9606] [188447] (625 PDB entries)
  8. 2545875Domain d3krxa2: 3krx A:186-549 [247256]
    Other proteins in same PDB: d3krxa1, d3krxa3, d3krxb_, d3krxg_
    automated match to d1omwa3
    complexed with ba1, mg

Details for d3krxa2

PDB Entry: 3krx (more details), 3.1 Å

PDB Description: Human GRK2 in complex with Gbetgamma subunits and balanol (co-crystal)
PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d3krxa2:

Sequence, based on SEQRES records: (download)

>d3krxa2 d.144.1.7 (A:186-549) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltmndfsvhriigrggfgevygcrkadtgkmyamkcldkkrikmkqgetlalnerimlsl
vstgdcpfivcmsyafhtpdklsfildlmnggdlhyhlsqhgvfseadmrfyaaeiilgl
ehmhnrfvvyrdlkpanilldehghvrisdlglacdfskkkphasvgthgymapevlqkg
vaydssadwfslgcmlfkllrghspfrqhktkdkheidrmtltmavelpdsfspelrsll
egllqrdvnrrlgclgrgaqevkespffrsldwqmvflqkyppplipprgevnaadafdi
gsfdeedtkgiklldsdqelyrnfpltiserwqqevaetvfdtinaetdrlearkkaknk
qlgh

Sequence, based on observed residues (ATOM records): (download)

>d3krxa2 d.144.1.7 (A:186-549) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltmndfsvhriigrggfgevygcrkadtgkmyamkcldkkrikmkqgetlalnerimlsl
vstgdcpfivcmsyafhtpdklsfildlmnggdlhyhlsqhgvfseadmrfyaaeiilgl
ehmhnrfvvyrdlkpanilldehghvrisdlglacdfskkkphasvgthgymapevlqkg
vaydssadwfslgcmlfkllrghspfrqhktkdkheidrmtltmavelpdsfspelrsll
egllqrdvnrrlgclgrgaqevkespffrsldwqmvflqkyppplippreedtkgiklld
sdqelyrnfpltiserwqqevaetvfdtinaetdrlearkkaknkqlgh

SCOPe Domain Coordinates for d3krxa2:

Click to download the PDB-style file with coordinates for d3krxa2.
(The format of our PDB-style files is described here.)

Timeline for d3krxa2: