Lineage for d3krxa1 (3krx A:30-185)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332890Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2332891Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2332952Family a.91.1.0: automated matches [191379] (1 protein)
    not a true family
  6. 2332953Protein automated matches [190464] (3 species)
    not a true protein
  7. 2332962Species Human (Homo sapiens) [TaxId:9606] [187381] (38 PDB entries)
  8. 2332990Domain d3krxa1: 3krx A:30-185 [247255]
    Other proteins in same PDB: d3krxa2, d3krxa3, d3krxb_, d3krxg_
    automated match to d1omwa1
    complexed with ba1, mg

Details for d3krxa1

PDB Entry: 3krx (more details), 3.1 Å

PDB Description: Human GRK2 in complex with Gbetgamma subunits and balanol (co-crystal)
PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d3krxa1:

Sequence, based on SEQRES records: (download)

>d3krxa1 a.91.1.0 (A:30-185) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclnhleearplvefyeei
kkyekleteeervarsreifdsyimkellacshpfsksatehvqghlgkkqvppdlfqpy
ieeicqnlrgdvfqkfiesdkftrfcqwknvelnih

Sequence, based on observed residues (ATOM records): (download)

>d3krxa1 a.91.1.0 (A:30-185) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclnhleearplvefyeei
kkyekleteeervarsreifdsyimkellahpfsksatehvqghlgkkqvppdlfqpyie
eicqnlrgdvfqkfiesdkftrfcqwknvelnih

SCOPe Domain Coordinates for d3krxa1:

Click to download the PDB-style file with coordinates for d3krxa1.
(The format of our PDB-style files is described here.)

Timeline for d3krxa1: