![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
![]() | Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) ![]() |
![]() | Family a.91.1.0: automated matches [191379] (1 protein) not a true family |
![]() | Protein automated matches [190464] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187381] (38 PDB entries) |
![]() | Domain d3krxa1: 3krx A:30-185 [247255] Other proteins in same PDB: d3krxa2, d3krxa3, d3krxb_, d3krxg_ automated match to d1omwa1 complexed with ba1, mg |
PDB Entry: 3krx (more details), 3.1 Å
SCOPe Domain Sequences for d3krxa1:
Sequence, based on SEQRES records: (download)
>d3krxa1 a.91.1.0 (A:30-185) automated matches {Human (Homo sapiens) [TaxId: 9606]} kkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclnhleearplvefyeei kkyekleteeervarsreifdsyimkellacshpfsksatehvqghlgkkqvppdlfqpy ieeicqnlrgdvfqkfiesdkftrfcqwknvelnih
>d3krxa1 a.91.1.0 (A:30-185) automated matches {Human (Homo sapiens) [TaxId: 9606]} kkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclnhleearplvefyeei kkyekleteeervarsreifdsyimkellahpfsksatehvqghlgkkqvppdlfqpyie eicqnlrgdvfqkfiesdkftrfcqwknvelnih
Timeline for d3krxa1: