Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) |
Family c.1.7.0: automated matches [191491] (1 protein) not a true family |
Protein automated matches [190793] (26 species) not a true protein |
Species Giardia lamblia [TaxId:184922] [255910] (1 PDB entry) |
Domain d3krbb1: 3krb B:1-313 [247254] Other proteins in same PDB: d3krba2, d3krbb2 automated match to d3guga_ complexed with edo, nap, unx |
PDB Entry: 3krb (more details), 1.75 Å
SCOPe Domain Sequences for d3krbb1:
Sequence, based on SEQRES records: (download)
>d3krbb1 c.1.7.0 (B:1-313) automated matches {Giardia lamblia [TaxId: 184922]} mqypprlgfgtwqappeavqtavetalmtgyrhidcayvyqneeaigrafgkifkdassg ikredvwitsklwnynhrpelvreqckktmsdlqvdyldlflvhwplafvrndvgdlfpk daegramlekvpladtwrameqlveeglvkhigvsnytvplladllnyakikplvnqiei hpwhpndatvkfcldngigvtayspmggsyadprdpsgtqknvilecktlkaiadakgts phcvalawhvkkwntsmysvipksqtparieanfkctevqlsdddmdainnihlnkrirf cdpaifwkvplfd
>d3krbb1 c.1.7.0 (B:1-313) automated matches {Giardia lamblia [TaxId: 184922]} mqypprlgfgtwqappeavqtavetalmtgyrhidcayvyqneeaigrafgkifkdassg ikredvwitsklwnynhrpelvreqckktmsdlqvdyldlflvhwplafvrndvgdlfpk daegramlekvpladtwrameqlveeglvkhigvsnytvplladllnyakikplvnqiei hpwhpndatvkfcldngigvtayspmggsyatqknvilecktlkaiadakgtsphcvala whvkkwntsmysvipksqtparieanfkctevqlsdddmdainnihlnkrirfcdpaifw kvplfd
Timeline for d3krbb1: