Lineage for d3krba1 (3krb A:1-313)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2081379Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 2081380Protein automated matches [190793] (26 species)
    not a true protein
  7. 2081444Species Giardia lamblia [TaxId:184922] [255910] (1 PDB entry)
  8. 2081445Domain d3krba1: 3krb A:1-313 [247253]
    Other proteins in same PDB: d3krba2, d3krbb2
    automated match to d3guga_
    complexed with edo, nap, unx

Details for d3krba1

PDB Entry: 3krb (more details), 1.75 Å

PDB Description: Structure of Aldose Reductase from Giardia Lamblia at 1.75A Resolution
PDB Compounds: (A:) aldose reductase

SCOPe Domain Sequences for d3krba1:

Sequence, based on SEQRES records: (download)

>d3krba1 c.1.7.0 (A:1-313) automated matches {Giardia lamblia [TaxId: 184922]}
mqypprlgfgtwqappeavqtavetalmtgyrhidcayvyqneeaigrafgkifkdassg
ikredvwitsklwnynhrpelvreqckktmsdlqvdyldlflvhwplafvrndvgdlfpk
daegramlekvpladtwrameqlveeglvkhigvsnytvplladllnyakikplvnqiei
hpwhpndatvkfcldngigvtayspmggsyadprdpsgtqknvilecktlkaiadakgts
phcvalawhvkkwntsmysvipksqtparieanfkctevqlsdddmdainnihlnkrirf
cdpaifwkvplfd

Sequence, based on observed residues (ATOM records): (download)

>d3krba1 c.1.7.0 (A:1-313) automated matches {Giardia lamblia [TaxId: 184922]}
mqypprlgfgtwqappeavqtavetalmtgyrhidcayvyqneeaigrafgkifkdassg
ikredvwitsklwnynhrpelvreqckktmsdlqvdyldlflvhwplafvrndvgdlfpk
daegramlekvpladtwrameqlveeglvkhigvsnytvplladllnyakikplvnqiei
hpwhpndatvkfcldngigvtayspmggsyatqknvilecktlkaiadakgtsphcvala
whvkkwntsmysvipksqtparieanfkctevqlsdddmdainnihlnkrirfcdpaifw
kvplfd

SCOPe Domain Coordinates for d3krba1:

Click to download the PDB-style file with coordinates for d3krba1.
(The format of our PDB-style files is described here.)

Timeline for d3krba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3krba2