SCOP 1.71: Domain d1hdza1: 1hdz A:1-162,A:339-374

Lineage for d1hdza1 (1hdz A:1-162,A:339-374)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (2 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Alcohol dehydrogenase [50137] (9 species)
   contains a Zn-finger subdomain, residues 94-117

7. Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (22 PDB entries)

8. Domain d1hdza1: 1hdz A:1-162,A:339-374 [24725]
   Other proteins in same PDB: d1hdza2, d1hdzb2

Details for d1hdza1

PDB Entry: 1hdz, 2.45 Å

PDB Description: three-dimensional structures of three human alcohol dehydrogenase variants: correlations with their functional differences

SCOP Domain Sequences for d1hdza1:

Sequence; same for both SEQRES and ATOM records:

>d1hdza1 b.35.1.2 (A:1-162,A:339-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgicgtddhvvsgnlvtp
lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaXkfsldalithvlpfeki
negfdllhsgksirtvltf

Timeline for d1hdza1:

• d1hdza1 first appeared (with stable ids) in SCOP 1.55
  
• d1hdza1 appears in SCOP 1.69
  
• d1hdza1 appears in SCOP 1.73
  
• d1hdza1 appears in the current release, SCOPe 2.08