Lineage for d1hdza1 (1hdz A:1-174,A:325-374)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13334Fold b.35: GroES-like [50128] (2 superfamilies)
  4. 13335Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 13363Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins)
  6. 13364Protein Alcohol dehydrogenase [50137] (4 species)
  7. 13415Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (13 PDB entries)
  8. 13436Domain d1hdza1: 1hdz A:1-174,A:325-374 [24725]
    Other proteins in same PDB: d1hdza2, d1hdzb2

Details for d1hdza1

PDB Entry: 1hdz (more details), 2.45 Å

PDB Description: three-dimensional structures of three human alcohol dehydrogenase variants: correlations with their functional differences

SCOP Domain Sequences for d1hdza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdza1 b.35.1.2 (A:1-174,A:325-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgicgtddhvvsgnlvtp
lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaasplekvcligcXkegip
klvadfmakkfsldalithvlpfekinegfdllhsgksirtvltf

SCOP Domain Coordinates for d1hdza1:

Click to download the PDB-style file with coordinates for d1hdza1.
(The format of our PDB-style files is described here.)

Timeline for d1hdza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hdza2