Class b: All beta proteins [48724] (176 folds) |
Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
Superfamily b.35.1: GroES-like [50129] (3 families) |
Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins) C-terminal domain is alpha/beta (classical Rossmann-fold) |
Protein Alcohol dehydrogenase [50137] (9 species) contains a Zn-finger subdomain, residues 94-117 |
Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (24 PDB entries) Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327 |
Domain d1hdyb1: 1hdy B:1-162,B:339-374 [24724] Other proteins in same PDB: d1hdya2, d1hdyb2 complexed with cl, nad, pyz, zn |
PDB Entry: 1hdy (more details), 2.5 Å
SCOPe Domain Sequences for d1hdyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hdyb1 b.35.1.2 (B:1-162,B:339-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgichtddhvvsgnlvtp lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaXkfsldalithvlpfeki negfdllhsgksirtvltf
Timeline for d1hdyb1: