SCOPe 2.04: Domain d1hdyb1: 1hdy B:1-162,B:339-374

Lineage for d1hdyb1 (1hdy B:1-162,B:339-374)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Alcohol dehydrogenase [50137] (9 species)
   contains a Zn-finger subdomain, residues 94-117

7. Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (24 PDB entries)
   Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327

8. Domain d1hdyb1: 1hdy B:1-162,B:339-374 [24724]
   Other proteins in same PDB: d1hdya2, d1hdyb2
   complexed with cl, nad, pyz, zn

Details for d1hdyb1

PDB Entry: 1hdy, 2.5 Å

PDB Description: three-dimensional structures of three human alcohol dehydrogenase variants: correlations with their functional differences

PDB Compounds: (B:) alcohol dehydrogenase

SCOPe Domain Sequences for d1hdyb1:

Sequence; same for both SEQRES and ATOM records:

>d1hdyb1 b.35.1.2 (B:1-162,B:339-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgichtddhvvsgnlvtp
lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaXkfsldalithvlpfeki
negfdllhsgksirtvltf

Timeline for d1hdyb1:

• d1hdyb1 first appeared (with stable ids) in SCOP 1.55
  
• d1hdyb1 appears in SCOPe 2.03
  
• d1hdyb1 appears in SCOPe 2.05
  
• d1hdyb1 appears in the current release, SCOPe 2.08