Lineage for d3km2f_ (3km2 F:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1769113Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 1769114Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 1769588Protein automated matches [190916] (9 species)
    not a true protein
  7. 1769607Species Solanum lycopersicum [TaxId:4081] [196089] (6 PDB entries)
  8. 1769626Domain d3km2f_: 3km2 F: [247222]
    automated match to d3hoga_
    complexed with zn

Details for d3km2f_

PDB Entry: 3km2 (more details), 3.1 Å

PDB Description: as-isolated tomato chloroplast superoxide dismutase
PDB Compounds: (F:) Superoxide dismutase [Cu-Zn], chloroplastic

SCOPe Domain Sequences for d3km2f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3km2f_ b.1.8.1 (F:) automated matches {Solanum lycopersicum [TaxId: 4081]}
atkkavavlkgnsnvegvvtlsqdddgpttvnvritglapglhgfhlheygdttngcmst
gahfnpnklthgapgdeirhagdlgnivanadgvaevtlvdnqipltgpnsvvgralvvh
eleddlgkgghelslttgnaggrlacgvvgltp

SCOPe Domain Coordinates for d3km2f_:

Click to download the PDB-style file with coordinates for d3km2f_.
(The format of our PDB-style files is described here.)

Timeline for d3km2f_: