Lineage for d3kjva2 (3kjv A:430-556)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2462855Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2464026Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2464027Protein automated matches [190396] (36 species)
    not a true protein
  7. 2464207Species Human immunodeficiency virus type 1 [TaxId:11706] [225515] (19 PDB entries)
  8. 2464224Domain d3kjva2: 3kjv A:430-556 [247215]
    Other proteins in same PDB: d3kjva1, d3kjvb_
    automated match to d1bqna1
    protein/DNA complex; complexed with mg, so4

Details for d3kjva2

PDB Entry: 3kjv (more details), 3.1 Å

PDB Description: HIV-1 reverse transcriptase in complex with DNA
PDB Compounds: (A:) Reverse transcriptase P66 SUBUNIT

SCOPe Domain Sequences for d3kjva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kjva2 c.55.3.0 (A:430-556) automated matches {Human immunodeficiency virus type 1 [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagi

SCOPe Domain Coordinates for d3kjva2:

Click to download the PDB-style file with coordinates for d3kjva2.
(The format of our PDB-style files is described here.)

Timeline for d3kjva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3kjva1
View in 3D
Domains from other chains:
(mouse over for more information)
d3kjvb_