Lineage for d3kjrb2 (3kjr B:205-508)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972108Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2972109Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2972770Family d.117.1.0: automated matches [227244] (1 protein)
    not a true family
  6. 2972771Protein automated matches [227010] (5 species)
    not a true protein
  7. 2972772Species Babesia bovis [TaxId:484906] [232544] (3 PDB entries)
  8. 2972774Domain d3kjrb2: 3kjr B:205-508 [247213]
    Other proteins in same PDB: d3kjra1, d3kjrb1
    automated match to d3i3ra2
    complexed with gol, nap, nhe

Details for d3kjrb2

PDB Entry: 3kjr (more details), 1.95 Å

PDB Description: Crystal structure of dihydrofolate reductase/thymidylate synthase from Babesia bovis determined using SlipChip based microfluidics
PDB Compounds: (B:) Dihydrofolate reductase/thymidylate synthase

SCOPe Domain Sequences for d3kjrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kjrb2 d.117.1.0 (B:205-508) automated matches {Babesia bovis [TaxId: 484906]}
gtdisvpkpkyvacpgvrirnheefqyldiladvlshgvlkpnrtgtdayskfgyqmrfd
lsrsfpllttkkvalrsiieellwfikgstngndllaknvriwelngrrdfldkngftdr
eehdlgpiygfqwrhfgaeyldmhadytgkgidqlaeiinriktnpndrrlivcswnvsd
lkkmalppchcffqfyvsdnklscmmhqrscdlglgvpfniasysiltamvaqvcglglg
efvhnladahiyvdhvdavttqiariphpfprlrlnpdirniedftiddivvedyvshpp
ipma

SCOPe Domain Coordinates for d3kjrb2:

Click to download the PDB-style file with coordinates for d3kjrb2.
(The format of our PDB-style files is described here.)

Timeline for d3kjrb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3kjrb1