| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
| Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
| Protein automated matches [190777] (21 species) not a true protein |
| Species Babesia bovis [TaxId:484906] [232542] (3 PDB entries) |
| Domain d3kjra1: 3kjr A:5-187 [247210] Other proteins in same PDB: d3kjra2, d3kjrb2 automated match to d3i3ra1 complexed with gol, nap, nhe |
PDB Entry: 3kjr (more details), 1.95 Å
SCOPe Domain Sequences for d3kjra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kjra1 c.71.1.0 (A:5-187) automated matches {Babesia bovis [TaxId: 484906]}
yegcgdltifvavalnkvighknqipwphithdfrflrngttyippevlsknpdiqnvvi
fgrktyesipkaslplknrinvilsrtvkevpgclvyedlstairdlranvphnkifilg
gsflykevldnglcdkiyltrlnkeypgdtyfpdipdtfeitaisptfstdfvsydfviy
erk
Timeline for d3kjra1: