Lineage for d3kjra1 (3kjr A:5-187)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2904032Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2904033Protein automated matches [190777] (28 species)
    not a true protein
  7. 2904120Species Babesia bovis [TaxId:484906] [232542] (3 PDB entries)
  8. 2904121Domain d3kjra1: 3kjr A:5-187 [247210]
    Other proteins in same PDB: d3kjra2, d3kjrb2
    automated match to d3i3ra1
    complexed with gol, nap, nhe

Details for d3kjra1

PDB Entry: 3kjr (more details), 1.95 Å

PDB Description: Crystal structure of dihydrofolate reductase/thymidylate synthase from Babesia bovis determined using SlipChip based microfluidics
PDB Compounds: (A:) Dihydrofolate reductase/thymidylate synthase

SCOPe Domain Sequences for d3kjra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kjra1 c.71.1.0 (A:5-187) automated matches {Babesia bovis [TaxId: 484906]}
yegcgdltifvavalnkvighknqipwphithdfrflrngttyippevlsknpdiqnvvi
fgrktyesipkaslplknrinvilsrtvkevpgclvyedlstairdlranvphnkifilg
gsflykevldnglcdkiyltrlnkeypgdtyfpdipdtfeitaisptfstdfvsydfviy
erk

SCOPe Domain Coordinates for d3kjra1:

Click to download the PDB-style file with coordinates for d3kjra1.
(The format of our PDB-style files is described here.)

Timeline for d3kjra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3kjra2