Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries) |
Domain d3kj4l2: 3kj4 L:113-219 [247209] Other proteins in same PDB: d3kj4a_, d3kj4b1, d3kj4d_, d3kj4l1 automated match to d3okka2 complexed with man, nag, ndg, zn |
PDB Entry: 3kj4 (more details), 3.1 Å
SCOPe Domain Sequences for d3kj4l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kj4l2 b.1.1.2 (L:113-219) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d3kj4l2:
View in 3D Domains from other chains: (mouse over for more information) d3kj4a_, d3kj4b1, d3kj4b2, d3kj4d_ |