Lineage for d3kj4d_ (3kj4 D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1834683Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 1834752Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 1834895Family c.10.2.7: Ngr ectodomain-like [75142] (7 proteins)
    this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain
  6. 1834932Protein automated matches [235852] (2 species)
    not a true protein
  7. 1834939Species Norway rat (Rattus norvegicus) [TaxId:10116] [255909] (1 PDB entry)
  8. 1834941Domain d3kj4d_: 3kj4 D: [247207]
    Other proteins in same PDB: d3kj4b1, d3kj4b2, d3kj4l1, d3kj4l2
    automated match to d1p8ta_
    complexed with man, nag, ndg, zn

Details for d3kj4d_

PDB Entry: 3kj4 (more details), 3.1 Å

PDB Description: structure of rat nogo receptor bound to 1d9 antagonist antibody
PDB Compounds: (D:) Reticulon-4 receptor

SCOPe Domain Sequences for d3kj4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kj4d_ c.10.2.7 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
cpgacvcynepkvttscpqqglqavptgipassqriflhgnrisyvpaasfqscrnltil
wlhsnalagidaaaftgltlleqldlsdnaqlrvvdpttfrglghlhtlhldrcglqelg
pglfrglaalqylylqdnnlqalpdntfrdlgnlthlflhgnripsvpehafrglhsldr
lllhqnhvarvhphafrdlgrlmtlylfannlsmlpaevlvplrslqylrlndnpwvcdc
rarplwawlqkfrgsssevpcnlpqrlagrdlkrlaasdlegc

SCOPe Domain Coordinates for d3kj4d_:

Click to download the PDB-style file with coordinates for d3kj4d_.
(The format of our PDB-style files is described here.)

Timeline for d3kj4d_: