Lineage for d3kj4b1 (3kj4 B:1-112)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2371390Domain d3kj4b1: 3kj4 B:1-112 [247205]
    Other proteins in same PDB: d3kj4a_, d3kj4b2, d3kj4d_, d3kj4l2
    automated match to d3okla1
    complexed with man, nag, ndg, zn

Details for d3kj4b1

PDB Entry: 3kj4 (more details), 3.1 Å

PDB Description: structure of rat nogo receptor bound to 1d9 antagonist antibody
PDB Compounds: (B:) Fab fragment 1D9 light chain

SCOPe Domain Sequences for d3kj4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kj4b1 b.1.1.0 (B:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmsqspsslavsagekvtmsckssqsllnsrnrknylawyqqkpgqspkpliywastr
esgvpdrftgsgsgtdftltissvqaedlavyycmqsynlftfgsgtkleik

SCOPe Domain Coordinates for d3kj4b1:

Click to download the PDB-style file with coordinates for d3kj4b1.
(The format of our PDB-style files is described here.)

Timeline for d3kj4b1: