![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
![]() | Superfamily c.10.2: L domain-like [52058] (9 families) ![]() less regular structure consisting of variable repeats |
![]() | Family c.10.2.7: Ngr ectodomain-like [75142] (7 proteins) |
![]() | Protein automated matches [235852] (2 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [255909] (1 PDB entry) |
![]() | Domain d3kj4a_: 3kj4 A: [247204] Other proteins in same PDB: d3kj4b1, d3kj4b2, d3kj4l1, d3kj4l2 automated match to d1p8ta_ complexed with man, nag, ndg, zn |
PDB Entry: 3kj4 (more details), 3.1 Å
SCOPe Domain Sequences for d3kj4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kj4a_ c.10.2.7 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} cpgacvcynepkvttscpqqglqavptgipassqriflhgnrisyvpaasfqscrnltil wlhsnalagidaaaftgltlleqldlsdnaqlrvvdpttfrglghlhtlhldrcglqelg pglfrglaalqylylqdnnlqalpdntfrdlgnlthlflhgnripsvpehafrglhsldr lllhqnhvarvhphafrdlgrlmtlylfannlsmlpaevlvplrslqylrlndnpwvcdc rarplwawlqkfrgsssevpcnlpqrlagrdlkrlaasdlegc
Timeline for d3kj4a_: