Lineage for d1d1tb1 (1d1t B:1-174,B:325-374)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.35: GroES-like [50128] (2 superfamilies) Superfamily b.35.1: GroES-like [50129] (2 families) 
Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins) Protein Alcohol dehydrogenase [50137] (4 species) 
Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (13 PDB entries) 
Domain d1d1tb1: 1d1t B:1-174,B:325-374 [24720]
Other proteins in same PDB: d1d1ta2, d1d1tb2, d1d1tc2, d1d1td2
Details for d1d1tb1
PDB Entry: 1d1t (more details), 2.4 Å
PDB Description: mutant of human sigma alcohol dehydrogenase with leucine at position 141
SCOP Domain Sequences for d1d1tb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d1tb1 b.35.1.2 (B:1-174,B:325-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
gtagkvikckaavlweqkqpfsieeievappktkevrikilatgicrtddhvikgtmvsk
fpvivgheatgivesigegvttvkpgdkviplflpqcrecnacrnpdgnlcirsditgrg
vladgttrftckgkpvhhflntstfteytvvdessvakiddaappekvcligcXrddvpk
lvteflakkfdldqlithvlpfkkisegfellnsgqsirtvltf
SCOP Domain Coordinates for d1d1tb1:
Click to download the PDB-style file with coordinates for d1d1tb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d1tb1:
View in 3D
