Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.5: ssDNA viruses [88645] (4 families) |
Family b.121.5.2: Parvoviridae-like VP [88646] (3 proteins) automatically mapped to Pfam PF00740 |
Protein automated matches [190920] (12 species) not a true protein |
Species Adeno-associated virus 3b [TaxId:68742] [255908] (2 PDB entries) |
Domain d3kieg_: 3kie G: [247190] automated match to d1lp3a_ complexed with d5m |
PDB Entry: 3kie (more details), 3 Å
SCOPe Domain Sequences for d3kieg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kieg_ b.121.5.2 (G:) automated matches {Adeno-associated virus 3b [TaxId: 68742]} gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn peiqytsnynksvnvdftvdtngvyseprpigtryltrnl
Timeline for d3kieg_: