Lineage for d3kiee_ (3kie E:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2076263Superfamily b.121.5: ssDNA viruses [88645] (3 families) (S)
  5. 2076282Family b.121.5.2: Parvoviridae-like VP [88646] (3 protein domains)
    automatically mapped to Pfam PF00740
  6. 2076308Protein automated matches [190920] (7 species)
    not a true protein
  7. 2076408Species Adeno-associated virus 3b [TaxId:68742] [255908] (2 PDB entries)
  8. 2076433Domain d3kiee_: 3kie E: [247188]
    automated match to d1lp3a_
    complexed with d5m

Details for d3kiee_

PDB Entry: 3kie (more details), 3 Å

PDB Description: crystal structure of adeno-associated virus serotype 3b
PDB Compounds: (E:) Capsid protein VP1

SCOPe Domain Sequences for d3kiee_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kiee_ b.121.5.2 (E:) automated matches {Adeno-associated virus 3b [TaxId: 68742]}
gadgvgnssgnwhcdsqwlgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkklsfklfniqvkevtqndgtttiannl
tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
yfpsqmlrtgnnfqfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqgttsgtt
nqsrllfsqagpqsmslqarnwlpgpcyrqqrlsktandnnnsnfpwtaaskyhlngrds
lvnpgpamashkddeekffpmhgnlifgkegttasnaeldnvmitdeeeirttnpvateq
ygtvannlqssntapttrtvndqgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
gfglkhpppqimikntpvpanppttfspakfasfitqystgqvsveiewelqkenskrwn
peiqytsnynksvnvdftvdtngvyseprpigtryltrnl

SCOPe Domain Coordinates for d3kiee_:

Click to download the PDB-style file with coordinates for d3kiee_.
(The format of our PDB-style files is described here.)

Timeline for d3kiee_: