SCOP 1.61: Domain d1hdxb1: 1hdx B:1-174,B:325-374

Lineage for d1hdxb1 (1hdx B:1-174,B:325-374)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)

4. Superfamily b.35.1: GroES-like [50129] (2 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins)

6. Protein Alcohol dehydrogenase [50137] (4 species)

7. Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (16 PDB entries)

8. Domain d1hdxb1: 1hdx B:1-174,B:325-374 [24718]
   Other proteins in same PDB: d1hdxa2, d1hdxb2

Details for d1hdxb1

PDB Entry: 1hdx, 2.5 Å

PDB Description: three-dimensional structures of three human alcohol dehydrogenase variants: correlations with their functional differences

SCOP Domain Sequences for d1hdxb1:

Sequence; same for both SEQRES and ATOM records:

>d1hdxb1 b.35.1.2 (B:1-174,B:325-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgicrtddhvvsgnlvtp
lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaasplekvcligcXkegip
klvadfmakkfsldalithvlpfekinegfdllhsgksirtvltf

Timeline for d1hdxb1:

• d1hdxb1 first appeared (with stable ids) in SCOP 1.55
  
• d1hdxb1 appears in SCOP 1.59
  
• d1hdxb1 appears in SCOP 1.63
  
• d1hdxb1 appears in the current release, SCOPe 2.08