SCOP 1.73: Domain d1hdxa1: 1hdx A:1-162,A:339-374

Lineage for d1hdxa1 (1hdx A:1-162,A:339-374)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (2 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Alcohol dehydrogenase [50137] (9 species)
   contains a Zn-finger subdomain, residues 94-117

7. Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (24 PDB entries)

8. Domain d1hdxa1: 1hdx A:1-162,A:339-374 [24717]
   Other proteins in same PDB: d1hdxa2, d1hdxb2

Details for d1hdxa1

PDB Entry: 1hdx, 2.5 Å

PDB Description: three-dimensional structures of three human alcohol dehydrogenase variants: correlations with their functional differences

PDB Compounds: (A:) alcohol dehydrogenase

SCOP Domain Sequences for d1hdxa1:

Sequence; same for both SEQRES and ATOM records:

>d1hdxa1 b.35.1.2 (A:1-162,A:339-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgicrtddhvvsgnlvtp
lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaXkfsldalithvlpfeki
negfdllhsgksirtvltf

Timeline for d1hdxa1:

• d1hdxa1 first appeared (with stable ids) in SCOP 1.55
  
• d1hdxa1 appears in SCOP 1.71
  
• d1hdxa1 appears in SCOP 1.75
  
• d1hdxa1 appears in the current release, SCOPe 2.08