Lineage for d3khoa_ (3kho A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2370739Domain d3khoa_: 3kho A: [247162]
    automated match to d3khqa_
    complexed with so4

Details for d3khoa_

PDB Entry: 3kho (more details), 3.11 Å

PDB Description: Crystal structure of murine Ig-beta (CD79b) homodimer
PDB Compounds: (A:) B-cell antigen receptor complex-associated protein beta chain

SCOPe Domain Sequences for d3khoa_:

Sequence, based on SEQRES records: (download)

>d3khoa_ b.1.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iwqhprfaakkrssmvkfhcytnhsgaltwfrkrgsqqpqelvseegrivqtqngsvytl
tiqniqyedngiyfckqkcdsanhnvtdscgtellvlgf

Sequence, based on observed residues (ATOM records): (download)

>d3khoa_ b.1.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iwqhprfaakkrssmvkfhcytnhsgaltwfrkrgsqqpqelvsgrivqtqngsvytlti
qniqyedngiyfckqkdscgtellvlgf

SCOPe Domain Coordinates for d3khoa_:

Click to download the PDB-style file with coordinates for d3khoa_.
(The format of our PDB-style files is described here.)

Timeline for d3khoa_: