| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (29 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) |
| Domain d3khoa_: 3kho A: [247162] automated match to d3khqa_ complexed with so4 |
PDB Entry: 3kho (more details), 3.11 Å
SCOPe Domain Sequences for d3khoa_:
Sequence, based on SEQRES records: (download)
>d3khoa_ b.1.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iwqhprfaakkrssmvkfhcytnhsgaltwfrkrgsqqpqelvseegrivqtqngsvytl
tiqniqyedngiyfckqkcdsanhnvtdscgtellvlgf
>d3khoa_ b.1.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iwqhprfaakkrssmvkfhcytnhsgaltwfrkrgsqqpqelvsgrivqtqngsvytlti
qniqyedngiyfckqkdscgtellvlgf
Timeline for d3khoa_: