SCOPe 2.08: Domain d3khoa_: 3kho A:

Lineage for d3khoa_ (3kho A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d3khoa_: 3kho A: [247162]
   automated match to d3khqa_
   complexed with so4

Details for d3khoa_

PDB Entry: 3kho, 3.11 Å

PDB Description: Crystal structure of murine Ig-beta (CD79b) homodimer

PDB Compounds: (A:) B-cell antigen receptor complex-associated protein beta chain

SCOPe Domain Sequences for d3khoa_:

Sequence, based on SEQRES records:

>d3khoa_ b.1.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iwqhprfaakkrssmvkfhcytnhsgaltwfrkrgsqqpqelvseegrivqtqngsvytl
tiqniqyedngiyfckqkcdsanhnvtdscgtellvlgf

Sequence, based on observed residues (ATOM records):

>d3khoa_ b.1.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iwqhprfaakkrssmvkfhcytnhsgaltwfrkrgsqqpqelvsgrivqtqngsvytlti
qniqyedngiyfckqkdscgtellvlgf

Timeline for d3khoa_:

• d3khoa_ first appeared in SCOPe 2.04
  
• d3khoa_ appears in SCOPe 2.07