Lineage for d3kh0a1 (3kh0 A:793-892)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2158220Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2159292Family d.15.1.5: Ras-binding domain, RBD [54263] (14 protein domains)
    contains Pfam PF00788 and Pfam PF02196
  6. 2159413Protein automated matches [190541] (1 species)
    not a true protein
  7. 2159414Species Human (Homo sapiens) [TaxId:9606] [187513] (2 PDB entries)
  8. 2159416Domain d3kh0a1: 3kh0 A:793-892 [247160]
    Other proteins in same PDB: d3kh0a2, d3kh0b2
    automated match to d1raxa_
    complexed with unx

Details for d3kh0a1

PDB Entry: 3kh0 (more details), 2.1 Å

PDB Description: crystal structure of the ras-association (ra) domain of ralgds
PDB Compounds: (A:) Ral guanine nucleotide dissociation stimulator

SCOPe Domain Sequences for d3kh0a1:

Sequence, based on SEQRES records: (download)

>d3kh0a1 d.15.1.5 (A:793-892) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nqqvgdcciirvsldvdngnmyksilvtsqdkapavirkamdkhnleeeepedyellqil
sddrklkipenanvfyamnstanydfvlkkrtftkgvkvk

Sequence, based on observed residues (ATOM records): (download)

>d3kh0a1 d.15.1.5 (A:793-892) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nqqvgdcciirvsldvdngnmyksilvtsqdkapavirkamdkhnleeeepedyellqil
sddrklkipenanvfyamnstanydfvlkkrtfkvk

SCOPe Domain Coordinates for d3kh0a1:

Click to download the PDB-style file with coordinates for d3kh0a1.
(The format of our PDB-style files is described here.)

Timeline for d3kh0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3kh0a2