SCOP 1.71: Domain d1htbb1: 1htb B:1-162,B:339-374

Lineage for d1htbb1 (1htb B:1-162,B:339-374)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (2 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Alcohol dehydrogenase [50137] (9 species)
   contains a Zn-finger subdomain, residues 94-117

7. Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (22 PDB entries)

8. Domain d1htbb1: 1htb B:1-162,B:339-374 [24716]
   Other proteins in same PDB: d1htba2, d1htbb2
   complexed with cl, nad, pyz, zn

Details for d1htbb1

PDB Entry: 1htb, 2.4 Å

PDB Description: crystallization of human beta3 alcohol dehydrogenase (10 mg/ml) in 100 mm sodium phosphate (ph 7.5), 7.5 mm nad+ and 1 mm 4-iodopyrazole at 25 c

SCOP Domain Sequences for d1htbb1:

Sequence; same for both SEQRES and ATOM records:

>d1htbb1 b.35.1.2 (B:1-162,B:339-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgicrtddhvvsgnlvtp
lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaXkfsldalithvlpfeki
negfdllhsgksictvltf

Timeline for d1htbb1:

• d1htbb1 first appeared (with stable ids) in SCOP 1.55
  
• d1htbb1 appears in SCOP 1.69
  
• d1htbb1 appears in SCOP 1.73
  
• d1htbb1 appears in the current release, SCOPe 2.08