Lineage for d1htbb1 (1htb B:1-174,B:325-374)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 227997Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 227998Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 228048Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (6 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 228049Protein Alcohol dehydrogenase [50137] (5 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 228120Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (17 PDB entries)
  8. 228136Domain d1htbb1: 1htb B:1-174,B:325-374 [24716]
    Other proteins in same PDB: d1htba2, d1htbb2
    complexed with cl, nad, pyz, zn

Details for d1htbb1

PDB Entry: 1htb (more details), 2.4 Å

PDB Description: crystallization of human beta3 alcohol dehydrogenase (10 mg/ml) in 100 mm sodium phosphate (ph 7.5), 7.5 mm nad+ and 1 mm 4-iodopyrazole at 25 c

SCOP Domain Sequences for d1htbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htbb1 b.35.1.2 (B:1-174,B:325-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgicrtddhvvsgnlvtp
lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaasplekvcligcXkegip
klvadfmakkfsldalithvlpfekinegfdllhsgksictvltf

SCOP Domain Coordinates for d1htbb1:

Click to download the PDB-style file with coordinates for d1htbb1.
(The format of our PDB-style files is described here.)

Timeline for d1htbb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1htbb2