SCOPe 2.06: Domain d3kfdb_: 3kfd B:

Lineage for d3kfdb_ (3kfd B:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)

6. Protein TGF-beta1 [57512] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57513] (5 PDB entries)

8. Domain d3kfdb_: 3kfd B: [247151]
   Other proteins in same PDB: d3kfde_, d3kfdf_, d3kfdg_, d3kfdh_
   automated match to d1klca_

Details for d3kfdb_

PDB Entry: 3kfd, 3 Å

PDB Description: Ternary complex of TGF-b1 reveals isoform-specific ligand recognition and receptor recruitment in the superfamily

PDB Compounds: (B:) Transforming growth factor beta-1

SCOPe Domain Sequences for d3kfdb_:

Sequence; same for both SEQRES and ATOM records:

>d3kfdb_ g.17.1.2 (B:) TGF-beta1 {Human (Homo sapiens) [TaxId: 9606]}
aldtnycfssteknccvrqlyidfrkdlgwkwihepkgyhanfclgpcpyiwsldtqysk
vlalynqhnpgasaapccvpqaleplpivyyvgrkpkveqlsnmivrsckcs

Timeline for d3kfdb_:

• d3kfdb_ first appeared in SCOPe 2.04
  
• d3kfdb_ appears in SCOPe 2.05
  
• d3kfdb_ appears in SCOPe 2.07
  
• d3kfdb_ appears in the current release, SCOPe 2.08