Class g: Small proteins [56992] (94 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins) |
Protein TGF-beta1 [57512] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57513] (5 PDB entries) |
Domain d3kfdb_: 3kfd B: [247151] Other proteins in same PDB: d3kfde_, d3kfdf_, d3kfdg_, d3kfdh_ automated match to d1klca_ |
PDB Entry: 3kfd (more details), 3 Å
SCOPe Domain Sequences for d3kfdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kfdb_ g.17.1.2 (B:) TGF-beta1 {Human (Homo sapiens) [TaxId: 9606]} aldtnycfssteknccvrqlyidfrkdlgwkwihepkgyhanfclgpcpyiwsldtqysk vlalynqhnpgasaapccvpqaleplpivyyvgrkpkveqlsnmivrsckcs
Timeline for d3kfdb_: