SCOPe 2.06: Domain d3ke1a_: 3ke1 A:

Lineage for d3ke1a_ (3ke1 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.5: IpsF-like [69765] (2 families)
   forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.5.0: automated matches [191525] (1 protein)
   not a true family

6. Protein automated matches [190884] (7 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:28450] [255823] (12 PDB entries)

8. Domain d3ke1a_: 3ke1 A: [247143]
   automated match to d3re3a_
   complexed with 829, k, zn

Details for d3ke1a_

PDB Entry: 3ke1, 2.05 Å

PDB Description: crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei in complex with a fragment- nucleoside fusion d000161829

PDB Compounds: (A:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d3ke1a_:

Sequence, based on SEQRES records:

>d3ke1a_ d.79.5.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
mdfrigqgydvhqlvpgrpliiggvtipyergllghsdadvllhaitdalfgaaalgdig
rhfsdtdprfkgadsrallrecasrvaqagfairnvdstiiaqapklaphidamraniaa
dldlpldrvnvkaktneklgylgrgegieaqaaalvvre

Sequence, based on observed residues (ATOM records):

>d3ke1a_ d.79.5.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
mdfrigqgydvhqlvpgrpliiggvtipyergllghsdadvllhaitdalfgaaalgdig
rhfadsrallrecasrvaqagfairnvdstiiaqapklaphidamraniaadldlpldrv
nvkaktneklgylgrgegieaqaaalvvre

Timeline for d3ke1a_:

• d3ke1a_ first appeared in SCOPe 2.04
  
• d3ke1a_ appears in SCOPe 2.05
  
• d3ke1a_ appears in SCOPe 2.07
  
• d3ke1a_ appears in the current release, SCOPe 2.08