Lineage for d1dehb1 (1deh B:1-174,B:325-374)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58601Fold b.35: GroES-like [50128] (2 superfamilies)
  4. 58602Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 58652Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins)
  6. 58653Protein Alcohol dehydrogenase [50137] (4 species)
  7. 58712Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (13 PDB entries)
  8. 58718Domain d1dehb1: 1deh B:1-174,B:325-374 [24714]
    Other proteins in same PDB: d1deha2, d1dehb2

Details for d1dehb1

PDB Entry: 1deh (more details), 2.2 Å

PDB Description: crystallization of human beta1 alcohol dehydrogenase (15 mg/ml) in 50 mm sodium phosphate (ph 7.5), 2.0 mm nad+ and 1 mm 4-iodopyrazole at 25 oc, 13% (w/v) peg 8000

SCOP Domain Sequences for d1dehb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dehb1 b.35.1.2 (B:1-174,B:325-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgicrtddhvvsgnlvtp
lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaasplekvcligcXkegip
klvadfmakkfsldalithvlpfekinegfdllhsgksirtvltf

SCOP Domain Coordinates for d1dehb1:

Click to download the PDB-style file with coordinates for d1dehb1.
(The format of our PDB-style files is described here.)

Timeline for d1dehb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dehb2