Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (188 species) not a true protein |
Species Geobacter metallireducens [TaxId:269799] [232459] (2 PDB entries) |
Domain d3kcmf_: 3kcm F: [247134] Other proteins in same PDB: d3kcma2, d3kcmb2 automated match to d4evma_ complexed with so4 |
PDB Entry: 3kcm (more details), 2.45 Å
SCOPe Domain Sequences for d3kcmf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kcmf_ c.47.1.0 (F:) automated matches {Geobacter metallireducens [TaxId: 269799]} enpapdftlntlngevvklsdlkgqvvivnfwatwcppcreeipsmmrlnaamagkpfrm lcvsideggkvaveeffrktgftlpvlldadkrvgklygttgvpetfvidrhgvilkkvv gamewdhpeviaflnnel
Timeline for d3kcmf_: