Lineage for d3kcmc_ (3kcm C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2134328Species Geobacter metallireducens [TaxId:269799] [232459] (2 PDB entries)
  8. 2134332Domain d3kcmc_: 3kcm C: [247132]
    Other proteins in same PDB: d3kcma2, d3kcmb2
    automated match to d4evma_
    complexed with so4

Details for d3kcmc_

PDB Entry: 3kcm (more details), 2.45 Å

PDB Description: the crystal structure of thioredoxin protein from geobacter metallireducens
PDB Compounds: (C:) Thioredoxin family protein

SCOPe Domain Sequences for d3kcmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kcmc_ c.47.1.0 (C:) automated matches {Geobacter metallireducens [TaxId: 269799]}
eenpapdftlntlngevvklsdlkgqvvivnfwatwcppcreeipsmmrlnaamagkpfr
mlcvsideggkvaveeffrktgftlpvlldadkrvgklygttgvpetfvidrhgvilkkv
vgamewdhpeviaflnnel

SCOPe Domain Coordinates for d3kcmc_:

Click to download the PDB-style file with coordinates for d3kcmc_.
(The format of our PDB-style files is described here.)

Timeline for d3kcmc_: