Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (133 species) not a true protein |
Species Geobacter metallireducens [TaxId:269799] [232459] (2 PDB entries) |
Domain d3kcmb_: 3kcm B: [247131] automated match to d4evma_ complexed with so4 |
PDB Entry: 3kcm (more details), 2.45 Å
SCOPe Domain Sequences for d3kcmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kcmb_ c.47.1.0 (B:) automated matches {Geobacter metallireducens [TaxId: 269799]} leenpapdftlntlngevvklsdlkgqvvivnfwatwcppcreeipsmmrlnaamagkpf rmlcvsideggkvaveeffrktgftlpvlldadkrvgklygttgvpetfvidrhgvilkk vvgamewdhpeviaflnnels
Timeline for d3kcmb_:
View in 3D Domains from other chains: (mouse over for more information) d3kcma_, d3kcmc_, d3kcme_, d3kcmf_ |