SCOPe 2.08: Domain d3kcmb1: 3kcm B:28-167

Lineage for d3kcmb1 (3kcm B:28-167)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Geobacter metallireducens [TaxId:269799] [232459] (2 PDB entries)

8. Domain d3kcmb1: 3kcm B:28-167 [247131]
   Other proteins in same PDB: d3kcma2, d3kcmb2
   automated match to d4evma_
   complexed with so4

Details for d3kcmb1

PDB Entry: 3kcm, 2.45 Å

PDB Description: the crystal structure of thioredoxin protein from geobacter metallireducens

PDB Compounds: (B:) Thioredoxin family protein

SCOPe Domain Sequences for d3kcmb1:

Sequence; same for both SEQRES and ATOM records:

>d3kcmb1 c.47.1.0 (B:28-167) automated matches {Geobacter metallireducens [TaxId: 269799]}
eenpapdftlntlngevvklsdlkgqvvivnfwatwcppcreeipsmmrlnaamagkpfr
mlcvsideggkvaveeffrktgftlpvlldadkrvgklygttgvpetfvidrhgvilkkv
vgamewdhpeviaflnnels

Timeline for d3kcmb1:

• d3kcmb1 first appeared in SCOPe 2.04, called d3kcmb_
  
• d3kcmb1 appears in SCOPe 2.07