Lineage for d3k9ba_ (3k9b A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134064Family c.69.1.1: Acetylcholinesterase-like [53475] (6 protein domains)
    automatically mapped to Pfam PF00135
  6. 2134301Protein automated matches [190065] (6 species)
    not a true protein
  7. 2134307Species Human (Homo sapiens) [TaxId:9606] [186857] (44 PDB entries)
  8. 2134365Domain d3k9ba_: 3k9b A: [247124]
    automated match to d1mx9d_
    complexed with ww2

Details for d3k9ba_

PDB Entry: 3k9b (more details), 3.1 Å

PDB Description: Crystal structure of human liver carboxylesterase 1 (hCE1) in covalent complex with the nerve agent Cyclosarin (GF)
PDB Compounds: (A:) Liver carboxylesterase 1

SCOPe Domain Sequences for d3k9ba_:

Sequence, based on SEQRES records: (download)

>d3k9ba_ c.69.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvknatsy
ppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwihggg
lmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrwvqd
niasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgdvkp
laeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllgtvi
dgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsllwk
syplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdagapt
ymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwanfa
rngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtn

Sequence, based on observed residues (ATOM records): (download)

>d3k9ba_ c.69.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvknatsy
ppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwihggg
lmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrwvqd
niasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgdvkp
laeqiaitagcktttsavmvhclrqkteeellettlkmkflgtvidgmlllktpeelqae
rtvpymvginkqefgwlipmlmsyplqktamsllwksyplvciakelipeatekylgvkk
kdlfldliadvmfgvpsvivarnhrdagaptymyeffssdmkpktvigdhgdelfsvfga
pflkeirlskmvmkfwanfarngnpngeglphwpeynqkegylqigantqaaqklkdkev
afwtn

SCOPe Domain Coordinates for d3k9ba_:

Click to download the PDB-style file with coordinates for d3k9ba_.
(The format of our PDB-style files is described here.)

Timeline for d3k9ba_: