Lineage for d3k6va_ (3k6v A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2163879Species Methanosarcina acetivorans [TaxId:2214] [255905] (3 PDB entries)
  8. 2163880Domain d3k6va_: 3k6v A: [247118]
    automated match to d2onke1
    complexed with cit

Details for d3k6va_

PDB Entry: 3k6v (more details), 1.69 Å

PDB Description: m. acetivorans molybdate-binding protein (moda) in citrate-bound open form
PDB Compounds: (A:) Solute-binding protein MA_0280

SCOPe Domain Sequences for d3k6va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k6va_ c.94.1.0 (A:) automated matches {Methanosarcina acetivorans [TaxId: 2214]}
evltvfhagslsvpfeeleaefeaqhpgvdvqreaagsaqsvrkitelgkkadvlasady
alipslmvpeyadwyaafarnqmilaytneskygdeintdnwyeilrrpdvrygfsnpnd
dpagyrsqmvtqlaesyynddmiyddlmlantgmtltteengtalihvpaseeispntsk
imlrsmevelssaletgeidylyiyrsvaeqhgfeyvalppaidlssleyadnyskvqve
mvngevvtgspivygvtipnnaenselatefvalllgetgqqifiengqppivpaiaegk
dsmpeelqalvv

SCOPe Domain Coordinates for d3k6va_:

Click to download the PDB-style file with coordinates for d3k6va_.
(The format of our PDB-style files is described here.)

Timeline for d3k6va_: