Lineage for d3k6ua_ (3k6u A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1624948Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1624949Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1626115Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1626116Protein automated matches [190039] (87 species)
    not a true protein
  7. Species Methanosarcina acetivorans [TaxId:2214] [255905] (3 PDB entries)
  8. 1626364Domain d3k6ua_: 3k6u A: [247117]
    automated match to d2onke1

Details for d3k6ua_

PDB Entry: 3k6u (more details), 1.95 Å

PDB Description: m. acetivorans molybdate-binding protein (moda) in unliganded open form
PDB Compounds: (A:) Solute-binding protein MA_0280

SCOPe Domain Sequences for d3k6ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k6ua_ c.94.1.0 (A:) automated matches {Methanosarcina acetivorans [TaxId: 2214]}
evltvfhagslsvpfeeleaefeaqhpgvdvqreaagsaqsvrkitelgkkadvlasady
alipslmvpeyadwyaafarnqmilaytneskygdeintdnwyeilrrpdvrygfsnpnd
dpagyrsqmvtqlaesyynddmiyddlmlantgmtltteengtalihvpaseeispntsk
imlrsmevelssaletgeidylyiyrsvaeqhgfeyvalppaidlssleyadnyskvqve
mvngevvtgspivygvtipnnaenselatefvalllgetgqqifiengqppivpaiaegk
dsmpeelqalvv

SCOPe Domain Coordinates for d3k6ua_:

Click to download the PDB-style file with coordinates for d3k6ua_.
(The format of our PDB-style files is described here.)

Timeline for d3k6ua_: