Lineage for d3k4xa3 (3k4x A:269-393)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2215792Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2215793Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2215978Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2216000Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)
  7. 2216008Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55990] (6 PDB entries)
    Uniprot P15873
  8. 2216015Domain d3k4xa3: 3k4x A:269-393 [247109]
    automated match to d1plqa1
    protein/DNA complex

Details for d3k4xa3

PDB Entry: 3k4x (more details), 2.98 Å

PDB Description: eukaryotic sliding clamp pcna bound to dna
PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d3k4xa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k4xa3 d.131.1.2 (A:269-393) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
leakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqeyr
cdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmdi
dadfl

SCOPe Domain Coordinates for d3k4xa3:

Click to download the PDB-style file with coordinates for d3k4xa3.
(The format of our PDB-style files is described here.)

Timeline for d3k4xa3: