| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
| Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins) duplication: consists of two domains of this fold |
| Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55990] (8 PDB entries) Uniprot P15873 |
| Domain d3k4xa3: 3k4x A:269-393 [247109] automated match to d1plqa1 protein/DNA complex |
PDB Entry: 3k4x (more details), 2.98 Å
SCOPe Domain Sequences for d3k4xa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k4xa3 d.131.1.2 (A:269-393) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
leakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqeyr
cdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmdi
dadfl
Timeline for d3k4xa3: