Lineage for d3k4xa2 (3k4x A:127-253)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1669824Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 1669825Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 1670010Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 1670032Protein Proliferating cell nuclear antigen (PCNA) [55989] (6 species)
  7. 1670040Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55990] (6 PDB entries)
    Uniprot P15873
  8. 1670046Domain d3k4xa2: 3k4x A:127-253 [247108]
    automated match to d1plqa2
    protein/DNA complex

Details for d3k4xa2

PDB Entry: 3k4x (more details), 2.98 Å

PDB Description: eukaryotic sliding clamp pcna bound to dna
PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d3k4xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k4xa2 d.131.1.2 (A:127-253) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsviikpfv
dmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfdlksgfl
qfflapk

SCOPe Domain Coordinates for d3k4xa2:

Click to download the PDB-style file with coordinates for d3k4xa2.
(The format of our PDB-style files is described here.)

Timeline for d3k4xa2: