SCOPe 2.08: Domain d3k2vb_: 3k2v B:

Lineage for d3k2vb_ (3k2v B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.0: automated matches [191603] (1 protein)
   not a true family

6. Protein automated matches [191100] (15 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:272620] [255903] (1 PDB entry)

8. Domain d3k2vb_: 3k2v B: [247103]
   automated match to d4o9kb_
   complexed with cmk, gol, so4

Details for d3k2vb_

PDB Entry: 3k2v, 1.95 Å

PDB Description: structure of the cbs pair of a putative d-arabinose 5-phosphate isomerase from klebsiella pneumoniae subsp. pneumoniae.

PDB Compounds: (B:) putative D-arabinose 5-phosphate isomerase

SCOPe Domain Sequences for d3k2vb_:

Sequence; same for both SEQRES and ATOM records:

>d3k2vb_ d.37.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
algrklllrvndimhtgdeiphvglqatlrdalleitrknlgmtaicdddmniigiftdg
dlrrvfdtgvdmrdasiadvmtrggirirpgtlavdalnlmqsrhitcvlvadgdhllgv
vhmhdllr

Timeline for d3k2vb_:

• d3k2vb_ first appeared in SCOPe 2.04
  
• d3k2vb_ appears in SCOPe 2.07